Lineage for d2caib1 (2cai B:85-207)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641765Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 641766Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 641767Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 641778Protein Class alpha GST [81349] (8 species)
  7. 641779Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (8 PDB entries)
  8. 641792Domain d2caib1: 2cai B:85-207 [130157]
    Other proteins in same PDB: d2caia2, d2caib2
    automatically matched to d1oe7a1
    complexed with bme, pg4, so4; mutant

Details for d2caib1

PDB Entry: 2cai (more details), 2.26 Å

PDB Description: structure of glutathione-s-transferase mutant, r21l, from schistosoma haematobium
PDB Compounds: (B:) glutathione s-transferase 28 kda

SCOP Domain Sequences for d2caib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2caib1 a.45.1.1 (B:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
dra

SCOP Domain Coordinates for d2caib1:

Click to download the PDB-style file with coordinates for d2caib1.
(The format of our PDB-style files is described here.)

Timeline for d2caib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2caib2