SCOP 1.75: Domain d2ca8a2: 2ca8 A:4-84

Lineage for d2ca8a2 (2ca8 A:4-84)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89704] (8 PDB entries)

8. Domain d2ca8a2: 2ca8 A:4-84 [130154]
   Other proteins in same PDB: d2ca8a1
   automatically matched to d1oe8b2
   complexed with gsw, pg4

Details for d2ca8a2

PDB Entry: 2ca8, 2.49 Å

PDB Description: Structure of Sh28GST in complex with GSH at pH 6.0

PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOP Domain Sequences for d2ca8a2:

Sequence; same for both SEQRES and ATOM records:

>d2ca8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
dhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
hvkwmveslaiarymakkhhm

Timeline for d2ca8a2:

• d2ca8a2 first appeared in SCOP 1.73
  
• d2ca8a2 appears in SCOPe 2.01
  
• d2ca8a2 appears in the current release, SCOPe 2.08