Lineage for d2ca8a1 (2ca8 A:85-211)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1735638Protein Class alpha GST [81349] (8 species)
  7. 1735639Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (4 PDB entries)
  8. 1735646Domain d2ca8a1: 2ca8 A:85-211 [130153]
    Other proteins in same PDB: d2ca8a2
    automated match to d1oe8a1
    complexed with gsh, pg4

Details for d2ca8a1

PDB Entry: 2ca8 (more details), 2.49 Å

PDB Description: Structure of Sh28GST in complex with GSH at pH 6.0
PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2ca8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ca8a1 a.45.1.1 (A:85-211) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
draatpf

SCOPe Domain Coordinates for d2ca8a1:

Click to download the PDB-style file with coordinates for d2ca8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ca8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ca8a2