![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.20: MxiH-like [140129] (2 families) ![]() Type III secretion system needle |
![]() | Family a.2.20.1: MxiH-like [140130] (3 proteins) |
![]() | Protein automated matches [190546] (1 species) not a true protein |
![]() | Species Shigella flexneri [TaxId:623] [187526] (1 PDB entry) |
![]() | Domain d2ca5b_: 2ca5 B: [130150] Other proteins in same PDB: d2ca5a1, d2ca5a2 automated match to d2ca5a1 complexed with gol, ipa, na |
PDB Entry: 2ca5 (more details), 2.1 Å
SCOPe Domain Sequences for d2ca5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ca5b_ a.2.20.1 (B:) automated matches {Shigella flexneri [TaxId: 623]} lsetfddgtqtlqgeltlaldklaknpsnpqllaeyqsklseytlyrnaqsntvkvikdv d
Timeline for d2ca5b_: