SCOPe 2.07: Domain d2ca5b_: 2ca5 B:

Lineage for d2ca5b_ (2ca5 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.20: MxiH-like [140129] (2 families)
   Type III secretion system needle

5. Family a.2.20.1: MxiH-like [140130] (3 proteins)

6. Protein automated matches [190546] (1 species)
   not a true protein

7. Species Shigella flexneri [TaxId:623] [187526] (1 PDB entry)

8. Domain d2ca5b_: 2ca5 B: [130150]
   Other proteins in same PDB: d2ca5a1, d2ca5a2
   automated match to d2ca5a1
   complexed with gol, ipa, na

Details for d2ca5b_

PDB Entry: 2ca5, 2.1 Å

PDB Description: mxih needle protein of shigella flexneri (monomeric form, residues 1-78)

PDB Compounds: (B:) mxih

SCOPe Domain Sequences for d2ca5b_:

Sequence; same for both SEQRES and ATOM records:

>d2ca5b_ a.2.20.1 (B:) automated matches {Shigella flexneri [TaxId: 623]}
lsetfddgtqtlqgeltlaldklaknpsnpqllaeyqsklseytlyrnaqsntvkvikdv
d

Timeline for d2ca5b_:

• d2ca5b_ first appeared in SCOP 1.73, called d2ca5b1
  
• d2ca5b_ appears in SCOPe 2.06
  
• d2ca5b_ appears in the current release, SCOPe 2.08