Lineage for d2ca5b_ (2ca5 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690748Superfamily a.2.20: MxiH-like [140129] (2 families) (S)
    Type III secretion system needle
  5. 2690749Family a.2.20.1: MxiH-like [140130] (3 proteins)
  6. 2690756Protein automated matches [190546] (1 species)
    not a true protein
  7. 2690757Species Shigella flexneri [TaxId:623] [187526] (1 PDB entry)
  8. 2690758Domain d2ca5b_: 2ca5 B: [130150]
    Other proteins in same PDB: d2ca5a1, d2ca5a2
    automated match to d2ca5a1
    complexed with gol, ipa, na

Details for d2ca5b_

PDB Entry: 2ca5 (more details), 2.1 Å

PDB Description: mxih needle protein of shigella flexneri (monomeric form, residues 1-78)
PDB Compounds: (B:) mxih

SCOPe Domain Sequences for d2ca5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ca5b_ a.2.20.1 (B:) automated matches {Shigella flexneri [TaxId: 623]}
lsetfddgtqtlqgeltlaldklaknpsnpqllaeyqsklseytlyrnaqsntvkvikdv
d

SCOPe Domain Coordinates for d2ca5b_:

Click to download the PDB-style file with coordinates for d2ca5b_.
(The format of our PDB-style files is described here.)

Timeline for d2ca5b_: