Lineage for d2ca5a1 (2ca5 A:20-78)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980678Superfamily a.2.20: MxiH-like [140129] (2 families) (S)
    Type III secretion system needle
  5. 1980679Family a.2.20.1: MxiH-like [140130] (3 proteins)
  6. 1980683Protein MxiH needle protein [140131] (1 species)
  7. 1980684Species Shigella flexneri [TaxId:623] [140132] (1 PDB entry)
    Uniprot P0A223 20-78
  8. 1980685Domain d2ca5a1: 2ca5 A:20-78 [130149]
    Other proteins in same PDB: d2ca5a2, d2ca5b_
    complexed with gol, ipa, na

Details for d2ca5a1

PDB Entry: 2ca5 (more details), 2.1 Å

PDB Description: mxih needle protein of shigella flexneri (monomeric form, residues 1-78)
PDB Compounds: (A:) mxih

SCOPe Domain Sequences for d2ca5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ca5a1 a.2.20.1 (A:20-78) MxiH needle protein {Shigella flexneri [TaxId: 623]}
ddgtqtlqgeltlaldklaknpsnpqllaeyqsklseytlyrnaqsntvkvikdvdaai

SCOPe Domain Coordinates for d2ca5a1:

Click to download the PDB-style file with coordinates for d2ca5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ca5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ca5a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2ca5b_