SCOPe 2.07: Domain d2c9wb_: 2c9w B:

Lineage for d2c9wb_ (2c9w B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries)

8. Domain d2c9wb_: 2c9w B: [130145]
   Other proteins in same PDB: d2c9wa1, d2c9wa2, d2c9wc_
   automated match to d1lm8b_
   complexed with ni, so4

Details for d2c9wb_

PDB Entry: 2c9w, 1.9 Å

PDB Description: crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution

PDB Compounds: (B:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d2c9wb_:

Sequence; same for both SEQRES and ATOM records:

>d2c9wb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
ftsqtarpqapatvglafraddtfealciepfssppelpdvmk

Timeline for d2c9wb_:

• d2c9wb_ first appeared in SCOP 1.73, called d2c9wb1
  
• d2c9wb_ appears in SCOPe 2.06
  
• d2c9wb_ appears in the current release, SCOPe 2.08