SCOPe 2.05: Domain d2c9pc_: 2c9p C:

Lineage for d2c9pc_ (2c9p C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)
   automatically mapped to Pfam PF04234
   automatically mapped to Pfam PF13205

6. Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species)

7. Species Pseudomonas syringae [TaxId:323] [187019] (2 PDB entries)

8. Domain d2c9pc_: 2c9p C: [130137]
   automated match to d1m42a_
   complexed with cu, no3

Details for d2c9pc_

PDB Entry: 2c9p, 2.25 Å

PDB Description: cu(i)cu(ii)-copc at ph 4.5

PDB Compounds: (C:) copper resistance protein c

SCOPe Domain Sequences for d2c9pc_:

Sequence; same for both SEQRES and ATOM records:

>d2c9pc_ b.1.18.17 (C:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 323]}
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk

Timeline for d2c9pc_:

• d2c9pc_ first appeared in SCOP 1.73, called d2c9pc1
  
• d2c9pc_ appears in SCOPe 2.04
  
• d2c9pc_ appears in SCOPe 2.06
  
• d2c9pc_ appears in the current release, SCOPe 2.08