SCOP 1.73: Domain d2c9pc1: 2c9p C:1-102

Lineage for d2c9pc1 (2c9p C:1-102)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)

6. Protein Copper resistance protein C (CopC, PcoC) [81970] (2 species)

7. Species Pseudomonas syringae [TaxId:317] [81971] (5 PDB entries)

8. Domain d2c9pc1: 2c9p C:1-102 [130137]
   automatically matched to d1m42a_
   complexed with cu, no3

Details for d2c9pc1

PDB Entry: 2c9p, 2.25 Å

PDB Description: cu(i)cu(ii)-copc at ph 4.5

PDB Compounds: (C:) copper resistance protein c

SCOP Domain Sequences for d2c9pc1:

Sequence; same for both SEQRES and ATOM records:

>d2c9pc1 b.1.18.17 (C:1-102) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 317]}
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk

Timeline for d2c9pc1:

• d2c9pc1 is new in SCOP 1.73
  
• d2c9pc1 appears in SCOP 1.75
  
• d2c9pc1 appears in the current release, SCOPe 2.08, called d2c9pc_