Lineage for d2c9nz1 (2c9n Z:178-236)
- Root: SCOP 1.73
Class h: Coiled coil proteins [57942] (7 folds) Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
this is not a true fold; includes oligomers of shorter identical helices
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) 
Family h.1.3.1: Leucine zipper domain [57960] (16 proteins) 
Protein Trans-activator protein BZLF1 [144260] (1 species) Species Human herpesvirus 4 [TaxId:10376] [144261] (2 PDB entries) 
Domain d2c9nz1: 2c9n Z:178-236 [130134]
automatically matched to 2C9N Y:178-236
Details for d2c9nz1
PDB Entry: 2c9n (more details), 3.3 Å
PDB Description: structure of the epstein-barr virus zebra protein at approximately 3.5 angstrom resolution
PDB Compounds: (Z:) bzlf1 trans-activator proteinSCOP Domain Sequences for d2c9nz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9nz1 h.1.3.1 (Z:178-236) Trans-activator protein BZLF1 {Human herpesvirus 4 [TaxId: 10376]}
kryknrvasrkcrakfkqllqhyrevaaakssendrlrlllkqmcpsldvdsiiprtpd
SCOP Domain Coordinates for d2c9nz1:
Click to download the PDB-style file with coordinates for d2c9nz1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c9nz1:
- d2c9nz1 is new in SCOP 1.73
- d2c9nz1 appears in SCOP 1.75
- d2c9nz1 appears in the current release, SCOPe 2.08
View in 3D
