Lineage for d2c9nz1 (2c9n Z:178-236)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039471Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 3039472Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 3039777Protein Trans-activator protein BZLF1 [144260] (1 species)
  7. 3039778Species Human herpesvirus 4 [TaxId:10376] [144261] (2 PDB entries)
    Uniprot P03206 175-236! Uniprot P03206 178-236
  8. 3039782Domain d2c9nz1: 2c9n Z:178-236 [130134]
    automatically matched to 2C9N Y:178-236

Details for d2c9nz1

PDB Entry: 2c9n (more details), 3.3 Å

PDB Description: structure of the epstein-barr virus zebra protein at approximately 3.5 angstrom resolution
PDB Compounds: (Z:) bzlf1 trans-activator protein

SCOPe Domain Sequences for d2c9nz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9nz1 h.1.3.1 (Z:178-236) Trans-activator protein BZLF1 {Human herpesvirus 4 [TaxId: 10376]}
kryknrvasrkcrakfkqllqhyrevaaakssendrlrlllkqmcpsldvdsiiprtpd

SCOPe Domain Coordinates for d2c9nz1:

Click to download the PDB-style file with coordinates for d2c9nz1.
(The format of our PDB-style files is described here.)

Timeline for d2c9nz1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c9ny1