![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (33 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.3: Leucine zipper domain [57959] (1 family) ![]() |
![]() | Family h.1.3.1: Leucine zipper domain [57960] (16 proteins) |
![]() | Protein Trans-activator protein BZLF1 [144260] (1 species) |
![]() | Species Human herpesvirus 4 [TaxId:10376] [144261] (2 PDB entries) |
![]() | Domain d2c9ny1: 2c9n Y:178-236 [130133] |
PDB Entry: 2c9n (more details), 3.3 Å
SCOP Domain Sequences for d2c9ny1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9ny1 h.1.3.1 (Y:178-236) Trans-activator protein BZLF1 {Human herpesvirus 4 [TaxId: 10376]} kryknrvasrkcrakfkqllqhyrevaaakssendrlrlllkqmcpsldvdsiiprtpd
Timeline for d2c9ny1: