Lineage for d2c9lz1 (2c9l Z:175-236)
- Root: SCOPe 2.08
Class h: Coiled coil proteins [57942] (7 folds) Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
this is not a true fold; includes oligomers of shorter identical helices
Superfamily h.1.3: Leucine zipper domain [57959] (2 families) 
Family h.1.3.1: Leucine zipper domain [57960] (17 proteins) 
Protein Trans-activator protein BZLF1 [144260] (1 species) Species Human herpesvirus 4 [TaxId:10376] [144261] (2 PDB entries)
Uniprot P03206 175-236! Uniprot P03206 178-236
Domain d2c9lz1: 2c9l Z:175-236 [130132]
automatically matched to 2C9L Y:175-236
Details for d2c9lz1
PDB Entry: 2c9l (more details), 2.25 Å
PDB Description: structure of the epstein-barr virus zebra protein
PDB Compounds: (Z:) bzlf1 trans-activator proteinSCOPe Domain Sequences for d2c9lz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9lz1 h.1.3.1 (Z:175-236) Trans-activator protein BZLF1 {Human herpesvirus 4 [TaxId: 10376]}
leikryknrvaarksrakfkqllqhyrevaaakssendrlrlllkqmcpsldvdsiiprt
pd
SCOPe Domain Coordinates for d2c9lz1:
Click to download the PDB-style file with coordinates for d2c9lz1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c9lz1:
- d2c9lz1 first appeared in SCOP 1.73
- d2c9lz1 appears in SCOPe 2.07
View in 3D
