![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.3: Leucine zipper domain [57959] (2 families) ![]() |
![]() | Family h.1.3.1: Leucine zipper domain [57960] (17 proteins) |
![]() | Protein Trans-activator protein BZLF1 [144260] (1 species) |
![]() | Species Human herpesvirus 4 [TaxId:10376] [144261] (2 PDB entries) Uniprot P03206 175-236! Uniprot P03206 178-236 |
![]() | Domain d2c9ly1: 2c9l Y:175-236 [130131] |
PDB Entry: 2c9l (more details), 2.25 Å
SCOPe Domain Sequences for d2c9ly1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9ly1 h.1.3.1 (Y:175-236) Trans-activator protein BZLF1 {Human herpesvirus 4 [TaxId: 10376]} leikryknrvaarksrakfkqllqhyrevaaakssendrlrlllkqmcpsldvdsiiprt pd
Timeline for d2c9ly1: