SCOP 1.73: Domain d2c9aa2: 2c9a A:21-183

Lineage for d2c9aa2 (2c9a A:21-183)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.25: MAM domain [141170] (1 protein)
   Pfam PF00629

6. Protein Receptor-type tyrosine-protein phosphatase mu [141171] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141172] (1 PDB entry)

8. Domain d2c9aa2: 2c9a A:21-183 [130130]
   Other proteins in same PDB: d2c9aa1
   complexed with ful, man, na, nag, ndg

Details for d2c9aa2

PDB Entry: 2c9a, 2.7 Å

PDB Description: crystal structure of the mam-ig module of receptor protein tyrosine phosphatase mu

PDB Compounds: (A:) receptor-type tyrosine-protein phosphatase mu

SCOP Domain Sequences for d2c9aa2:

Sequence; same for both SEQRES and ATOM records:

>d2c9aa2 b.29.1.25 (A:21-183) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]}
etfsggclfdepystcgysqsegddfnweqvntltkptsdpwmpsgsfmlvnasgrpegq
rahlllpqlkendthcidfhyfvssksnsppgllnvyvkvnngplgnpiwnisgdptrtw
nraelaistfwpnfyqvifevitsghqgylaidevkvlghpct

Timeline for d2c9aa2:

• d2c9aa2 is new in SCOP 1.73
  
• d2c9aa2 appears in SCOP 1.75
  
• d2c9aa2 appears in the current release, SCOPe 2.08