Lineage for d2c9aa2 (2c9a A:21-183)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780598Family b.29.1.25: MAM domain [141170] (1 protein)
    Pfam PF00629
  6. 2780599Protein Receptor-type tyrosine-protein phosphatase mu [141171] (1 species)
  7. 2780600Species Human (Homo sapiens) [TaxId:9606] [141172] (1 PDB entry)
    Uniprot P28827 21-183
  8. 2780601Domain d2c9aa2: 2c9a A:21-183 [130130]
    Other proteins in same PDB: d2c9aa1
    complexed with na, nag

Details for d2c9aa2

PDB Entry: 2c9a (more details), 2.7 Å

PDB Description: crystal structure of the mam-ig module of receptor protein tyrosine phosphatase mu
PDB Compounds: (A:) receptor-type tyrosine-protein phosphatase mu

SCOPe Domain Sequences for d2c9aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9aa2 b.29.1.25 (A:21-183) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]}
etfsggclfdepystcgysqsegddfnweqvntltkptsdpwmpsgsfmlvnasgrpegq
rahlllpqlkendthcidfhyfvssksnsppgllnvyvkvnngplgnpiwnisgdptrtw
nraelaistfwpnfyqvifevitsghqgylaidevkvlghpct

SCOPe Domain Coordinates for d2c9aa2:

Click to download the PDB-style file with coordinates for d2c9aa2.
(The format of our PDB-style files is described here.)

Timeline for d2c9aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c9aa1