SCOP 1.75: Domain d2c9aa1: 2c9a A:184-279

Lineage for d2c9aa1 (2c9a A:184-279)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (38 proteins)

6. Protein Receptor-type tyrosine-protein phosphatase mu [141015] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141016] (1 PDB entry)
   Uniprot P28827 184-279

8. Domain d2c9aa1: 2c9a A:184-279 [130129]
   Other proteins in same PDB: d2c9aa2
   complexed with ful, man, na, nag, ndg

Details for d2c9aa1

PDB Entry: 2c9a, 2.7 Å

PDB Description: crystal structure of the mam-ig module of receptor protein tyrosine phosphatase mu

PDB Compounds: (A:) receptor-type tyrosine-protein phosphatase mu

SCOP Domain Sequences for d2c9aa1:

Sequence; same for both SEQRES and ATOM records:

>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]}
rtphflriqnvevnagqfatfqcsaigrtvagdrlwlqgidvrdaplkeikvtssrrfia
sfnvvnttkrdagkyrcmirteggvgisnyaelvvk

Timeline for d2c9aa1:

• d2c9aa1 first appeared in SCOP 1.73
  
• d2c9aa1 appears in SCOPe 2.01
  
• d2c9aa1 appears in the current release, SCOPe 2.08