Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (38 proteins) |
Protein Receptor-type tyrosine-protein phosphatase mu [141015] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141016] (1 PDB entry) Uniprot P28827 184-279 |
Domain d2c9aa1: 2c9a A:184-279 [130129] Other proteins in same PDB: d2c9aa2 complexed with ful, man, na, nag, ndg |
PDB Entry: 2c9a (more details), 2.7 Å
SCOP Domain Sequences for d2c9aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} rtphflriqnvevnagqfatfqcsaigrtvagdrlwlqgidvrdaplkeikvtssrrfia sfnvvnttkrdagkyrcmirteggvgisnyaelvvk
Timeline for d2c9aa1: