Lineage for d2c9aa1 (2c9a A:184-279)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656838Family b.1.1.4: I set domains [49159] (36 proteins)
  6. 657126Protein Receptor-type tyrosine-protein phosphatase mu [141015] (1 species)
  7. 657127Species Human (Homo sapiens) [TaxId:9606] [141016] (1 PDB entry)
  8. 657128Domain d2c9aa1: 2c9a A:184-279 [130129]
    Other proteins in same PDB: d2c9aa2
    complexed with ful, man, na, nag, ndg

Details for d2c9aa1

PDB Entry: 2c9a (more details), 2.7 Å

PDB Description: crystal structure of the mam-ig module of receptor protein tyrosine phosphatase mu
PDB Compounds: (A:) receptor-type tyrosine-protein phosphatase mu

SCOP Domain Sequences for d2c9aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]}
rtphflriqnvevnagqfatfqcsaigrtvagdrlwlqgidvrdaplkeikvtssrrfia
sfnvvnttkrdagkyrcmirteggvgisnyaelvvk

SCOP Domain Coordinates for d2c9aa1:

Click to download the PDB-style file with coordinates for d2c9aa1.
(The format of our PDB-style files is described here.)

Timeline for d2c9aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c9aa2