Lineage for d2c9aa1 (2c9a A:184-279)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753884Protein Receptor-type tyrosine-protein phosphatase mu [141015] (1 species)
  7. 2753885Species Human (Homo sapiens) [TaxId:9606] [141016] (1 PDB entry)
    Uniprot P28827 184-279
  8. 2753886Domain d2c9aa1: 2c9a A:184-279 [130129]
    Other proteins in same PDB: d2c9aa2
    complexed with na, nag

Details for d2c9aa1

PDB Entry: 2c9a (more details), 2.7 Å

PDB Description: crystal structure of the mam-ig module of receptor protein tyrosine phosphatase mu
PDB Compounds: (A:) receptor-type tyrosine-protein phosphatase mu

SCOPe Domain Sequences for d2c9aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]}
rtphflriqnvevnagqfatfqcsaigrtvagdrlwlqgidvrdaplkeikvtssrrfia
sfnvvnttkrdagkyrcmirteggvgisnyaelvvk

SCOPe Domain Coordinates for d2c9aa1:

Click to download the PDB-style file with coordinates for d2c9aa1.
(The format of our PDB-style files is described here.)

Timeline for d2c9aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c9aa2