SCOPe 2.07: Domain d2c8va_: 2c8v A:

Lineage for d2c8va_ (2c8v A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Nitrogenase iron protein [52661] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (25 PDB entries)

8. Domain d2c8va_: 2c8v A: [130128]
   automated match to d1de0a_
   complexed with atp, fes, mg

Details for d2c8va_

PDB Entry: 2c8v, 2.5 Å

PDB Description: Insights into the role of nucleotide-dependent conformational change in nitrogenase catalysis: Structural characterization of the nitrogenase Fe protein Leu127 deletion variant with bound MgATP

PDB Compounds: (A:) nitrogenase iron protein 1

SCOPe Domain Sequences for d2c8va_:

Sequence; same for both SEQRES and ATOM records:

>d2c8va_ c.37.1.10 (A:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgg
licnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyr
alarkvvdnkllvipnpitmdeleellmefgi

Timeline for d2c8va_:

• d2c8va_ first appeared in SCOP 1.73, called d2c8va1
  
• d2c8va_ appears in SCOPe 2.06
  
• d2c8va_ appears in the current release, SCOPe 2.08