SCOP 1.73: Domain d2c8va1: 2c8v A:1-272

Lineage for d2c8va1 (2c8v A:1-272)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Nitrogenase iron protein [52661] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (15 PDB entries)

8. Domain d2c8va1: 2c8v A:1-272 [130128]
   automatically matched to d1rw4a_
   complexed with atp, fs1, mg

Details for d2c8va1

PDB Entry: 2c8v, 2.5 Å

PDB Description: Insights into the role of nucleotide-dependent conformational change in nitrogenase catalysis: Structural characterization of the nitrogenase Fe protein Leu127 deletion variant with bound MgATP

PDB Compounds: (A:) nitrogenase iron protein 1

SCOP Domain Sequences for d2c8va1:

Sequence; same for both SEQRES and ATOM records:

>d2c8va1 c.37.1.10 (A:1-272) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgg
licnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyr
alarkvvdnkllvipnpitmdeleellmefg

Timeline for d2c8va1:

• d2c8va1 is new in SCOP 1.73
  
• d2c8va1 appears in SCOP 1.75
  
• d2c8va1 appears in the current release, SCOPe 2.08, called d2c8va_