Lineage for d2c8ub1 (2c8u B:85-205)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326706Protein automated matches [226848] (13 species)
    not a true protein
  7. 2326707Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225081] (4 PDB entries)
  8. 2326710Domain d2c8ub1: 2c8u B:85-205 [130126]
    Other proteins in same PDB: d2c8ua2, d2c8ub2
    automated match to d2f8fa1
    complexed with bme, so4; mutant

Details for d2c8ub1

PDB Entry: 2c8u (more details), 2 Å

PDB Description: Structure of R21Q mutant of Sh28GST
PDB Compounds: (B:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2c8ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c8ub1 a.45.1.1 (B:85-205) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
d

SCOPe Domain Coordinates for d2c8ub1:

Click to download the PDB-style file with coordinates for d2c8ub1.
(The format of our PDB-style files is described here.)

Timeline for d2c8ub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c8ub2