SCOPe 2.04: Domain d2c8ua1: 2c8u A:85-205

Lineage for d2c8ua1 (2c8u A:85-205)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (10 species)
   not a true protein

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225081] (4 PDB entries)

8. Domain d2c8ua1: 2c8u A:85-205 [130124]
   Other proteins in same PDB: d2c8ua2, d2c8ub2
   automated match to d2f8fa1
   complexed with bme, so4; mutant

Details for d2c8ua1

PDB Entry: 2c8u, 2 Å

PDB Description: Structure of R21Q mutant of Sh28GST

PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2c8ua1:

Sequence; same for both SEQRES and ATOM records:

>d2c8ua1 a.45.1.1 (A:85-205) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
d

Timeline for d2c8ua1:

• d2c8ua1 first appeared in SCOP 1.73
  
• d2c8ua1 appears in SCOPe 2.03
  
• d2c8ua1 appears in SCOPe 2.05
  
• d2c8ua1 appears in the current release, SCOPe 2.08