SCOP 1.73: Domain d2c8ua1: 2c8u A:85-205

Lineage for d2c8ua1 (2c8u A:85-205)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (8 PDB entries)

8. Domain d2c8ua1: 2c8u A:85-205 [130124]
   Other proteins in same PDB: d2c8ua2, d2c8ub2
   automatically matched to d1oe7a1
   complexed with bme, so4; mutant

Details for d2c8ua1

PDB Entry: 2c8u, 2 Å

PDB Description: Structure of R21Q mutant of Sh28GST

PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOP Domain Sequences for d2c8ua1:

Sequence; same for both SEQRES and ATOM records:

>d2c8ua1 a.45.1.1 (A:85-205) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
d

Timeline for d2c8ua1:

• d2c8ua1 is new in SCOP 1.73
  
• d2c8ua1 appears in SCOP 1.75
  
• d2c8ua1 appears in the current release, SCOPe 2.08