![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
![]() | Protein Class alpha GST [81349] (8 species) |
![]() | Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (8 PDB entries) |
![]() | Domain d2c8ua1: 2c8u A:85-205 [130124] Other proteins in same PDB: d2c8ua2, d2c8ub2 automatically matched to d1oe7a1 complexed with bme, so4; mutant |
PDB Entry: 2c8u (more details), 2 Å
SCOP Domain Sequences for d2c8ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c8ua1 a.45.1.1 (A:85-205) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls d
Timeline for d2c8ua1: