![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome c-L (MoxG) [109645] (1 species) |
![]() | Species Methylobacterium extorquens [TaxId:408] [109646] (1 PDB entry) Uniprot P14774 49-197 |
![]() | Domain d2c8sa_: 2c8s A: [130123] automated match to d2d0wa_ complexed with ca, hem |
PDB Entry: 2c8s (more details), 1.6 Å
SCOPe Domain Sequences for d2c8sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c8sa_ a.3.1.1 (A:) Cytochrome c-L (MoxG) {Methylobacterium extorquens [TaxId: 408]} sqgkeggrdtpavkkfletgenlyiddksclrngeslfatscsgchghlaegklgpglnd nywtypsnttdvglfatifggangmmgphnenltpdemlqtiawirhlytgpkqdavwln deqkkaytpykqgevipkdakgqckplde
Timeline for d2c8sa_: