SCOPe 2.05: Domain d2c8sa_: 2c8s A:

Lineage for d2c8sa_ (2c8s A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c-L (MoxG) [109645] (1 species)

7. Species Methylobacterium extorquens [TaxId:408] [109646] (1 PDB entry)
   Uniprot P14774 49-197

8. Domain d2c8sa_: 2c8s A: [130123]
   automated match to d2d0wa_
   complexed with ca, hem

Details for d2c8sa_

PDB Entry: 2c8s, 1.6 Å

PDB Description: cytochrome cl from methylobacterium extorquens

PDB Compounds: (A:) cytochrome c-l

SCOPe Domain Sequences for d2c8sa_:

Sequence; same for both SEQRES and ATOM records:

>d2c8sa_ a.3.1.1 (A:) Cytochrome c-L (MoxG) {Methylobacterium extorquens [TaxId: 408]}
sqgkeggrdtpavkkfletgenlyiddksclrngeslfatscsgchghlaegklgpglnd
nywtypsnttdvglfatifggangmmgphnenltpdemlqtiawirhlytgpkqdavwln
deqkkaytpykqgevipkdakgqckplde

Timeline for d2c8sa_:

• d2c8sa_ first appeared in SCOP 1.73, called d2c8sa1
  
• d2c8sa_ appears in SCOPe 2.04
  
• d2c8sa_ appears in SCOPe 2.06
  
• d2c8sa_ appears in the current release, SCOPe 2.08