Lineage for d2c8sa1 (2c8s A:24-172)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760660Protein Cytochrome c-L (MoxG) [109645] (1 species)
  7. 760661Species Methylobacterium extorquens [TaxId:408] [109646] (1 PDB entry)
    Uniprot P14774 49-197
  8. 760662Domain d2c8sa1: 2c8s A:24-172 [130123]
    automatically matched to d1umma_
    complexed with ca, hem

Details for d2c8sa1

PDB Entry: 2c8s (more details), 1.6 Å

PDB Description: cytochrome cl from methylobacterium extorquens
PDB Compounds: (A:) cytochrome c-l

SCOP Domain Sequences for d2c8sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c8sa1 a.3.1.1 (A:24-172) Cytochrome c-L (MoxG) {Methylobacterium extorquens [TaxId: 408]}
sqgkeggrdtpavkkfletgenlyiddksclrngeslfatscsgchghlaegklgpglnd
nywtypsnttdvglfatifggangmmgphnenltpdemlqtiawirhlytgpkqdavwln
deqkkaytpykqgevipkdakgqckplde

SCOP Domain Coordinates for d2c8sa1:

Click to download the PDB-style file with coordinates for d2c8sa1.
(The format of our PDB-style files is described here.)

Timeline for d2c8sa1: