![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
![]() | Protein Cytochrome c-L (MoxG) [109645] (1 species) |
![]() | Species Methylobacterium extorquens [TaxId:408] [109646] (1 PDB entry) |
![]() | Domain d2c8sa1: 2c8s A:24-172 [130123] automatically matched to d1umma_ complexed with ca, hem |
PDB Entry: 2c8s (more details), 1.6 Å
SCOP Domain Sequences for d2c8sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c8sa1 a.3.1.1 (A:24-172) Cytochrome c-L (MoxG) {Methylobacterium extorquens [TaxId: 408]} sqgkeggrdtpavkkfletgenlyiddksclrngeslfatscsgchghlaegklgpglnd nywtypsnttdvglfatifggangmmgphnenltpdemlqtiawirhlytgpkqdavwln deqkkaytpykqgevipkdakgqckplde
Timeline for d2c8sa1: