![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Alpha-L-arabinofuranosidase, catalytic domain [102075] (2 species) glycosyl hydrolase family 51 |
![]() | Species Clostridium thermocellum [TaxId:1515] [141779] (2 PDB entries) Uniprot Q4CJG5 17-386 |
![]() | Domain d2c8nc2: 2c8n C:17-386 [130114] Other proteins in same PDB: d2c8na1, d2c8nb1, d2c8nc1, d2c8nd1, d2c8ne1, d2c8nf1 automated match to d2c7fa2 complexed with edo |
PDB Entry: 2c8n (more details), 2.9 Å
SCOPe Domain Sequences for d2c8nc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c8nc2 c.1.8.3 (C:17-386) Alpha-L-arabinofuranosidase, catalytic domain {Clostridium thermocellum [TaxId: 1515]} idkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkelnvpiirypggnfvsn yfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaeimmavnlgtrgisdac nlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvghktmdeygriaeeta ramkmidpsielvacgssskdmptfpqweatvldyaydyvdyislhqyygnkendtadfl aksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnnedanimqnepwriap pllediytfedallvglmlitlmkhadrikiaclaqlinviapivternggaawrqtify pfmhaskygr
Timeline for d2c8nc2: