Lineage for d2c8nc2 (2c8n C:17-386)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830562Protein Alpha-L-arabinofuranosidase, catalytic domain [102075] (2 species)
    glycosyl hydrolase family 51
  7. 2830574Species Clostridium thermocellum [TaxId:1515] [141779] (2 PDB entries)
    Uniprot Q4CJG5 17-386
  8. 2830583Domain d2c8nc2: 2c8n C:17-386 [130114]
    Other proteins in same PDB: d2c8na1, d2c8nb1, d2c8nc1, d2c8nd1, d2c8ne1, d2c8nf1
    automated match to d2c7fa2
    complexed with edo

Details for d2c8nc2

PDB Entry: 2c8n (more details), 2.9 Å

PDB Description: the structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,3-linked arabinoside of xylobiose.
PDB Compounds: (C:) alpha-l-arabinofuranosidase

SCOPe Domain Sequences for d2c8nc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c8nc2 c.1.8.3 (C:17-386) Alpha-L-arabinofuranosidase, catalytic domain {Clostridium thermocellum [TaxId: 1515]}
idkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkelnvpiirypggnfvsn
yfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaeimmavnlgtrgisdac
nlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvghktmdeygriaeeta
ramkmidpsielvacgssskdmptfpqweatvldyaydyvdyislhqyygnkendtadfl
aksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnnedanimqnepwriap
pllediytfedallvglmlitlmkhadrikiaclaqlinviapivternggaawrqtify
pfmhaskygr

SCOPe Domain Coordinates for d2c8nc2:

Click to download the PDB-style file with coordinates for d2c8nc2.
(The format of our PDB-style files is described here.)

Timeline for d2c8nc2: