SCOPe 2.08: Domain d2c8nc1: 2c8n C:4-16,C:387-502

Lineage for d2c8nc1 (2c8n C:4-16,C:387-502)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Alpha-l-arabinofuranosidase [101924] (2 species)
   glycosyl hydrolase family 51

7. Species Clostridium thermocellum [TaxId:1515] [141554] (2 PDB entries)
   Uniprot Q4CJG5 2-16,387-502

8. Domain d2c8nc1: 2c8n C:4-16,C:387-502 [130113]
   Other proteins in same PDB: d2c8na2, d2c8nb2, d2c8nc2, d2c8nd2, d2c8ne2, d2c8nf2
   automated match to d2c7fa1
   complexed with edo

Details for d2c8nc1

PDB Entry: 2c8n, 2.9 Å

PDB Description: the structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,3-linked arabinoside of xylobiose.

PDB Compounds: (C:) alpha-l-arabinofuranosidase

SCOPe Domain Sequences for d2c8nc1:

Sequence; same for both SEQRES and ATOM records:

>d2c8nc1 b.71.1.2 (C:4-16,C:387-502) Alpha-l-arabinofuranosidase {Clostridium thermocellum [TaxId: 1515]}
armtvdkdykiaeXgivlqpvinsplhdtskhedvtdiesvaiyneekeevtifavnrni
hedivlvsdvrgmkdyrllehivlehqdlkirnsvngeevypknsdkssfddgiltsmlr
raswnvirig

Timeline for d2c8nc1:

• d2c8nc1 first appeared in SCOP 1.73
  
• d2c8nc1 appears in SCOPe 2.07