Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
Protein Alpha-l-arabinofuranosidase [101924] (2 species) glycosyl hydrolase family 51 |
Species Clostridium thermocellum [TaxId:1515] [141554] (2 PDB entries) Uniprot Q4CJG5 2-16,387-502 |
Domain d2c8nb1: 2c8n B:3-16,B:387-502 [130111] Other proteins in same PDB: d2c8na2, d2c8nb2, d2c8nc2, d2c8nd2, d2c8ne2, d2c8nf2 automated match to d2c7fa1 complexed with edo |
PDB Entry: 2c8n (more details), 2.9 Å
SCOPe Domain Sequences for d2c8nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c8nb1 b.71.1.2 (B:3-16,B:387-502) Alpha-l-arabinofuranosidase {Clostridium thermocellum [TaxId: 1515]} karmtvdkdykiaeXgivlqpvinsplhdtskhedvtdiesvaiyneekeevtifavnrn ihedivlvsdvrgmkdyrllehivlehqdlkirnsvngeevypknsdkssfddgiltsml rraswnvirig
Timeline for d2c8nb1: