Class g: Small proteins [56992] (85 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) |
Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins) Pfam PF00084 |
Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90173] (15 PDB entries) |
Domain d2c8ie2: 2c8i E:64-128 [130106] Other proteins in same PDB: d2c8ia1, d2c8ic1 automatically matched to d1nwva1 |
PDB Entry: 2c8i (more details), 16 Å
SCOP Domain Sequences for d2c8ie2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c8ie2 g.18.1.1 (E:64-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} rscevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwstav efckk
Timeline for d2c8ie2: