Lineage for d2c8ie2 (2c8i E:64-128)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034131Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 3034132Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)
  8. 3034219Domain d2c8ie2: 2c8i E:64-128 [130106]
    Other proteins in same PDB: d2c8ia1, d2c8ic1
    automatically matched to d1nwva1

Details for d2c8ie2

PDB Entry: 2c8i (more details)

PDB Description: complex of echovirus type 12 with domains 1, 2, 3 and 4 of its receptor decay accelerating factor (cd55) by cryo electron microscopy at 16 a
PDB Compounds: (E:) complement decay-accelerating factor

SCOPe Domain Sequences for d2c8ie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c8ie2 g.18.1.1 (E:64-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
rscevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwstav
efckk

SCOPe Domain Coordinates for d2c8ie2:

Click to download the PDB-style file with coordinates for d2c8ie2.
(The format of our PDB-style files is described here.)

Timeline for d2c8ie2: