SCOPe 2.07: Domain d2c8ic1: 2c8i C:1-238

Lineage for d2c8ic1 (2c8i C:1-238)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Human enterovirus B coat proteins [88635] (4 species)

7. Species Human echovirus 11 [TaxId:12078] [74890] (3 PDB entries)

8. Domain d2c8ic1: 2c8i C:1-238 [130104]
   Other proteins in same PDB: d2c8ie1, d2c8ie2, d2c8ie3, d2c8ie4
   automatically matched to d1h8tc_

Details for d2c8ic1

PDB Entry: 2c8i

PDB Description: complex of echovirus type 12 with domains 1, 2, 3 and 4 of its receptor decay accelerating factor (cd55) by cryo electron microscopy at 16 a

PDB Compounds: (C:) echovirus 11 coat protein vp3

SCOPe Domain Sequences for d2c8ic1:

Sequence; same for both SEQRES and ATOM records:

>d2c8ic1 b.121.4.1 (C:1-238) Human enterovirus B coat proteins {Human echovirus 11 [TaxId: 12078]}
glpvintpgsnqfltsddfqspsampqfdvtpelnipgevqnlmeiaevdsvvpvnnvag
nletmdiyripvqsgnhqssqvfgfqvqpgldgvfkhtllgeilnyyahwsgsikltfvf
cgsamatgkfllayappganapksrkdamlgthiiwdvglqsscvlcipwisqthyrlvq
qdeytsagnvtcwyqtgivvpagtptscsimcfvsacndfsvrllkdtpfiqqaallq

Timeline for d2c8ic1:

• d2c8ic1 first appeared in SCOP 1.73
  
• d2c8ic1 appears in SCOPe 2.06
  
• d2c8ic1 appears in the current release, SCOPe 2.08