| Class b: All beta proteins [48724] (180 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
| Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
| Protein Human enterovirus B coat proteins [88635] (4 species) |
| Species Human echovirus 11 [TaxId:12078] [74890] (3 PDB entries) |
| Domain d2c8ia1: 2c8i A:1-289 [130103] Other proteins in same PDB: d2c8ie1, d2c8ie2, d2c8ie3, d2c8ie4 automatically matched to d1h8ta_ |
PDB Entry: 2c8i (more details)
SCOPe Domain Sequences for d2c8ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c8ia1 b.121.4.1 (A:1-289) Human enterovirus B coat proteins {Human echovirus 11 [TaxId: 12078]}
gdvveavenavarvadtigsgpsnsqavpaltavetghtsqvtpsdtvqtrhvknyhsrs
essienflsrsacvymgeyhttnsdqtklfaswtisarrmvqmrrkleiftyvrfdvevt
fvitskqdqgtqlgqdmpplthqimyippggpipksvtdytwqtstnpsifwtegnappr
msipfisignaysnfydgwshfsqngvygyntlnhmgqiyvrhvngssplpmtstvrmyf
kpkhvkawvprpprlcqyknastvnfsptditdkrnsityipdtvkpdv
Timeline for d2c8ia1: