Lineage for d2c8aa1 (2c8a A:45-251)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 877625Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 877626Superfamily d.166.1: ADP-ribosylation [56399] (7 families) (S)
  5. 877627Family d.166.1.1: ADP-ribosylating toxins [56400] (9 proteins)
  6. 877680Protein Exoenzyme c3 [56414] (3 species)
  7. 877688Species Clostridium botulinum [TaxId:1491] [56415] (8 PDB entries)
    Uniprot P15879 41-251
  8. 877689Domain d2c8aa1: 2c8a A:45-251 [130099]
    automatically matched to d1g24a_
    complexed with nca, so4

Details for d2c8aa1

PDB Entry: 2c8a (more details), 1.7 Å

PDB Description: structure of the wild-type c3bot1 exoenzyme (nicotinamide-bound state, crystal form i)
PDB Compounds: (A:) Mono-ADP-ribosyltransferase C3

SCOP Domain Sequences for d2c8aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c8aa1 d.166.1.1 (A:45-251) Exoenzyme c3 {Clostridium botulinum [TaxId: 1491]}
tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
iddmrlssdgkqiiitatmmgtainpk

SCOP Domain Coordinates for d2c8aa1:

Click to download the PDB-style file with coordinates for d2c8aa1.
(The format of our PDB-style files is described here.)

Timeline for d2c8aa1: