Lineage for d2c89a1 (2c89 A:45-244)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737530Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 737531Superfamily d.166.1: ADP-ribosylation [56399] (7 families) (S)
  5. 737532Family d.166.1.1: ADP-ribosylating toxins [56400] (9 proteins)
  6. 737580Protein Exoenzyme c3 [56414] (3 species)
  7. 737588Species Clostridium botulinum [TaxId:1491] [56415] (8 PDB entries)
  8. 737598Domain d2c89a1: 2c89 A:45-244 [130095]
    automatically matched to d1g24a_
    complexed with so4

Details for d2c89a1

PDB Entry: 2c89 (more details), 1.85 Å

PDB Description: structure of the wild-type c3bot1 exoenzyme (free state, crystal form i)
PDB Compounds: (A:) Mono-ADP-ribosyltransferase C3

SCOP Domain Sequences for d2c89a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c89a1 d.166.1.1 (A:45-244) Exoenzyme c3 {Clostridium botulinum [TaxId: 1491]}
tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
iddmrlssdgkqiiitatmm

SCOP Domain Coordinates for d2c89a1:

Click to download the PDB-style file with coordinates for d2c89a1.
(The format of our PDB-style files is described here.)

Timeline for d2c89a1: