Lineage for d2c86b_ (2c86 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433791Fold b.148: Coronavirus RNA-binding domain [110303] (1 superfamily)
    coiled antiparallel beta-sheet of 5 strands, order 51324; complex topology, crossing loops
  4. 2433792Superfamily b.148.1: Coronavirus RNA-binding domain [110304] (1 family) (S)
    automatically mapped to Pfam PF00937
  5. 2433793Family b.148.1.1: Coronavirus RNA-binding domain [110305] (1 protein)
    N-terminal part of Pfam PF00937
  6. 2433794Protein Nucleocapsid protein [110306] (2 species)
  7. 2433795Species Avian infectious bronchitis virus [TaxId:11120] [141560] (4 PDB entries)
    Uniprot P32923 23-160! Uniprot P69596 29-160! Uniprot P69597 29-160
    different strains
  8. 2433803Domain d2c86b_: 2c86 B: [130094]
    automated match to d2bxxb_

Details for d2c86b_

PDB Entry: 2c86 (more details), 3 Å

PDB Description: x-ray structure of the n and c-terminal domain of coronavirus nucleocapsid protein.
PDB Compounds: (B:) nucleocapsid protein

SCOPe Domain Sequences for d2c86b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c86b_ b.148.1.1 (B:) Nucleocapsid protein {Avian infectious bronchitis virus [TaxId: 11120]}
hmssgnaswfqaikakklntpppkfegsgvpdnenikpsqqhgywrrqarfkpgkggrcp
vpdawyfyytgtgpaadlnwgdtqdgivwvaakgadtksrsnqgtrdpdkfdqyplrfsd
ggpdgnfrwdfipl

SCOPe Domain Coordinates for d2c86b_:

Click to download the PDB-style file with coordinates for d2c86b_.
(The format of our PDB-style files is described here.)

Timeline for d2c86b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c86a_