SCOPe 2.08: Domain d2c86a_: 2c86 A:

Lineage for d2c86a_ (2c86 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.148: Coronavirus RNA-binding domain [110303] (1 superfamily)
   coiled antiparallel beta-sheet of 5 strands, order 51324; complex topology, crossing loops

4. Superfamily b.148.1: Coronavirus RNA-binding domain [110304] (1 family)
   automatically mapped to Pfam PF00937

5. Family b.148.1.1: Coronavirus RNA-binding domain [110305] (1 protein)
   N-terminal part of Pfam PF00937

6. Protein Nucleocapsid protein [110306] (2 species)

7. Species Avian infectious bronchitis virus [TaxId:11120] [141560] (4 PDB entries)
   Uniprot P32923 23-160! Uniprot P69596 29-160! Uniprot P69597 29-160
   different strains

8. Domain d2c86a_: 2c86 A: [130093]
   automated match to d2bxxb_

Details for d2c86a_

PDB Entry: 2c86, 3 Å

PDB Description: x-ray structure of the n and c-terminal domain of coronavirus nucleocapsid protein.

PDB Compounds: (A:) nucleocapsid protein

SCOPe Domain Sequences for d2c86a_:

Sequence; same for both SEQRES and ATOM records:

>d2c86a_ b.148.1.1 (A:) Nucleocapsid protein {Avian infectious bronchitis virus [TaxId: 11120]}
hmssgnaswfqaikakklntpppkfegsgvpdnenikpsqqhgywrrqarfkpgkggrcp
vpdawyfyytgtgpaadlnwgdtqdgivwvaakgadtksrsnqgtrdpdkfdqyplrfsd
ggpdgnfrwdfipl

Timeline for d2c86a_:

• d2c86a_ first appeared in SCOP 1.73, called d2c86a1
  
• d2c86a_ appears in SCOPe 2.07