Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (4 PDB entries) |
Domain d2c80b1: 2c80 B:85-211 [130091] Other proteins in same PDB: d2c80a2, d2c80b2 automated match to d1oe8a1 complexed with gtx, pg4 |
PDB Entry: 2c80 (more details), 2.3 Å
SCOPe Domain Sequences for d2c80b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c80b1 a.45.1.1 (B:85-211) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls draatpf
Timeline for d2c80b1: