SCOP 1.73: Domain d2c80b1: 2c80 B:85-207

Lineage for d2c80b1 (2c80 B:85-207)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (8 PDB entries)

8. Domain d2c80b1: 2c80 B:85-207 [130091]
   Other proteins in same PDB: d2c80a2, d2c80b2
   automatically matched to d1oe7a1
   complexed with gtx, pg4

Details for d2c80b1

PDB Entry: 2c80, 2.3 Å

PDB Description: Structure of Sh28GST in complex with S-hexyl Glutathione

PDB Compounds: (B:) glutathione s-transferase 28 kda

SCOP Domain Sequences for d2c80b1:

Sequence; same for both SEQRES and ATOM records:

>d2c80b1 a.45.1.1 (B:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
dra

Timeline for d2c80b1:

• d2c80b1 is new in SCOP 1.73
  
• d2c80b1 appears in SCOP 1.75
  
• d2c80b1 appears in the current release, SCOPe 2.08