Lineage for d2c7ra1 (2c7r A:1-327)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 704977Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins)
  6. 704982Protein DNA methylase HhaI [53367] (1 species)
  7. 704983Species Haemophilus haemolyticus [TaxId:726] [53368] (20 PDB entries)
  8. 704987Domain d2c7ra1: 2c7r A:1-327 [130082]
    automatically matched to d1fjxa_
    complexed with 5cm, a1p, gol, sah, so4; mutant

Details for d2c7ra1

PDB Entry: 2c7r (more details), 1.9 Å

PDB Description: HhaI DNA methyltransferase complex with oligonucleotide containing 2- aminopurine as a target base (GPGC:GMGC) and SAH
PDB Compounds: (A:) modification methylase hhai

SCOP Domain Sequences for d2c7ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c7ra1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaiglsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOP Domain Coordinates for d2c7ra1:

Click to download the PDB-style file with coordinates for d2c7ra1.
(The format of our PDB-style files is described here.)

Timeline for d2c7ra1: