SCOPe 2.01: Domain d2c7qa_: 2c7q A:

Lineage for d2c7qa_ (2c7q A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (4 proteins)

6. Protein automated matches [190244] (2 species)
   not a true protein

7. Species Haemophilus haemolyticus [TaxId:726] [187017] (6 PDB entries)

8. Domain d2c7qa_: 2c7q A: [130081]
   automated match to d10mha_
   protein/DNA complex; complexed with cit, sah, so4

Details for d2c7qa_

PDB Entry: 2c7q, 1.85 Å

PDB Description: hhai dna methyltransferase complex with oligonucleotide containing 2- aminopurine outside the recognition sequence (paired with g) and sah

PDB Compounds: (A:) modification methylase hhai

SCOPe Domain Sequences for d2c7qa_:

Sequence; same for both SEQRES and ATOM records:

>d2c7qa_ c.66.1.26 (A:) automated matches {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

Timeline for d2c7qa_:

• d2c7qa_ first appeared in SCOP 1.73, called d2c7qa1
  
• d2c7qa_ was called d2c7qa1 in SCOP 1.75
  
• d2c7qa_ appears in SCOPe 2.02
  
• d2c7qa_ appears in the current release, SCOPe 2.08