SCOPe 2.07: Domain d2c7oa_: 2c7o A:

Lineage for d2c7oa_ (2c7o A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
   automatically mapped to Pfam PF00145

6. Protein automated matches [190244] (3 species)
   not a true protein

7. Species Haemophilus haemolyticus [TaxId:726] [187017] (6 PDB entries)

8. Domain d2c7oa_: 2c7o A: [130079]
   automated match to d10mha_
   protein/DNA complex; complexed with sah, so4

Details for d2c7oa_

PDB Entry: 2c7o, 1.9 Å

PDB Description: hhai dna methyltransferase complex with 13mer oligonucleotide containing 2-aminopurine adjacent to the target base (pcgc:gmgc) and sah

PDB Compounds: (A:) modification methylase hhai

SCOPe Domain Sequences for d2c7oa_:

Sequence; same for both SEQRES and ATOM records:

>d2c7oa_ c.66.1.26 (A:) automated matches {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

Timeline for d2c7oa_:

• d2c7oa_ first appeared in SCOP 1.73, called d2c7oa1
  
• d2c7oa_ appears in SCOPe 2.06
  
• d2c7oa_ appears in the current release, SCOPe 2.08