SCOP 1.73: Domain d2c7oa1: 2c7o A:1-327

Lineage for d2c7oa1 (2c7o A:1-327)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins)

6. Protein DNA methylase HhaI [53367] (1 species)

7. Species Haemophilus haemolyticus [TaxId:726] [53368] (20 PDB entries)

8. Domain d2c7oa1: 2c7o A:1-327 [130079]
   automatically matched to d10mha_
   complexed with 5cm, a1p, sah, so4

Details for d2c7oa1

PDB Entry: 2c7o, 1.9 Å

PDB Description: hhai dna methyltransferase complex with 13mer oligonucleotide containing 2-aminopurine adjacent to the target base (pcgc:gmgc) and sah

PDB Compounds: (A:) modification methylase hhai

SCOP Domain Sequences for d2c7oa1:

Sequence; same for both SEQRES and ATOM records:

>d2c7oa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

Timeline for d2c7oa1:

• d2c7oa1 is new in SCOP 1.73
  
• d2c7oa1 appears in SCOP 1.75
  
• d2c7oa1 appears in the current release, SCOPe 2.08, called d2c7oa_