SCOPe 2.04: Domain d2c7ng1: 2c7n G:17-71

Lineage for d2c7ng1 (2c7n G:17-71)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.15: A20-like zinc finger [144187] (1 protein)
   Pfam PF01754

6. Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species)
   binds to ubiquitin with the extended C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [144190] (2 PDB entries)
   Uniprot Q9UJ41 17-74

8. Domain d2c7ng1: 2c7n G:17-71 [130074]
   Other proteins in same PDB: d2c7nb1, d2c7nd1, d2c7nf1, d2c7nh1, d2c7nj1, d2c7nl1
   automatically matched to 2C7M A:18-75
   complexed with zn

Details for d2c7ng1

PDB Entry: 2c7n, 2.1 Å

PDB Description: human rabex-5 residues 1-74 in complex with ubiquitin

PDB Compounds: (G:) rab guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d2c7ng1:

Sequence; same for both SEQRES and ATOM records:

>d2c7ng1 g.39.1.15 (G:17-71) RabGEF1 (Rabex-5), ubiquitin-binding domain {Human (Homo sapiens) [TaxId: 9606]}
llckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafas

Timeline for d2c7ng1:

• d2c7ng1 first appeared in SCOP 1.73
  
• d2c7ng1 appears in SCOPe 2.03
  
• d2c7ng1 appears in SCOPe 2.05
  
• d2c7ng1 appears in the current release, SCOPe 2.08