Lineage for d2c7ng1 (2c7n G:17-71)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1463401Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1463402Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1463892Family g.39.1.15: A20-like zinc finger [144187] (1 protein)
    Pfam PF01754
  6. 1463893Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species)
    binds to ubiquitin with the extended C-terminal helix
  7. 1463899Species Human (Homo sapiens) [TaxId:9606] [144190] (2 PDB entries)
    Uniprot Q9UJ41 17-74
  8. 1463902Domain d2c7ng1: 2c7n G:17-71 [130074]
    Other proteins in same PDB: d2c7nb1, d2c7nd1, d2c7nf1, d2c7nh1, d2c7nj1, d2c7nl1
    automatically matched to 2C7M A:18-75
    complexed with zn

Details for d2c7ng1

PDB Entry: 2c7n (more details), 2.1 Å

PDB Description: human rabex-5 residues 1-74 in complex with ubiquitin
PDB Compounds: (G:) rab guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d2c7ng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c7ng1 g.39.1.15 (G:17-71) RabGEF1 (Rabex-5), ubiquitin-binding domain {Human (Homo sapiens) [TaxId: 9606]}
llckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafas

SCOPe Domain Coordinates for d2c7ng1:

Click to download the PDB-style file with coordinates for d2c7ng1.
(The format of our PDB-style files is described here.)

Timeline for d2c7ng1: