Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.3: beta-glycanases [51487] (24 proteins) consist of a number of sequence families |
Protein Alpha-L-arabinofuranosidase, catalytic domain [102075] (2 species) glycosyl hydrolase family 51 |
Species Clostridium thermocellum [TaxId:1515] [141779] (2 PDB entries) |
Domain d2c7ff2: 2c7f F:17-386 [130066] Other proteins in same PDB: d2c7fa1, d2c7fb1, d2c7fc1, d2c7fd1, d2c7fe1, d2c7ff1 automatically matched to 2C7F A:17-386 complexed with ahr, edo; mutant |
PDB Entry: 2c7f (more details), 2.7 Å
SCOP Domain Sequences for d2c7ff2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7ff2 c.1.8.3 (F:17-386) Alpha-L-arabinofuranosidase, catalytic domain {Clostridium thermocellum [TaxId: 1515]} idkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkelnvpiirypggnfvsn yfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaeimmavnlgtrgisdac nlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvghktmdeygriaeeta ramkmidpsielvacgssskdmptfpqweatvldyaydyvdyislhqyygnkendtadfl aksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnnedanimqnepwriap pllediytfedallvglmlitlmkhadrikiaclaqlinviapivternggaawrqtify pfmhaskygr
Timeline for d2c7ff2: