Lineage for d2c7ff2 (2c7f F:17-386)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682589Family c.1.8.3: beta-glycanases [51487] (24 proteins)
    consist of a number of sequence families
  6. 682594Protein Alpha-L-arabinofuranosidase, catalytic domain [102075] (2 species)
    glycosyl hydrolase family 51
  7. 682604Species Clostridium thermocellum [TaxId:1515] [141779] (2 PDB entries)
  8. 682610Domain d2c7ff2: 2c7f F:17-386 [130066]
    Other proteins in same PDB: d2c7fa1, d2c7fb1, d2c7fc1, d2c7fd1, d2c7fe1, d2c7ff1
    automatically matched to 2C7F A:17-386
    complexed with ahr, edo; mutant

Details for d2c7ff2

PDB Entry: 2c7f (more details), 2.7 Å

PDB Description: the structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,5-alpha-l-arabinotriose.
PDB Compounds: (F:) alpha-l-arabinofuranosidase

SCOP Domain Sequences for d2c7ff2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c7ff2 c.1.8.3 (F:17-386) Alpha-L-arabinofuranosidase, catalytic domain {Clostridium thermocellum [TaxId: 1515]}
idkriygsfvehlgravydglyqpgnsksdedgfrkdvielvkelnvpiirypggnfvsn
yfwedgvgpvedrprrldlawksiepnqvginefakwckkvnaeimmavnlgtrgisdac
nlleycnhpggskysdmrikhgvkephnikvwclgnamdgpwqvghktmdeygriaeeta
ramkmidpsielvacgssskdmptfpqweatvldyaydyvdyislhqyygnkendtadfl
aksddlddfirsviatcdyikakkrskkdiylsfdewnvwyhsnnedanimqnepwriap
pllediytfedallvglmlitlmkhadrikiaclaqlinviapivternggaawrqtify
pfmhaskygr

SCOP Domain Coordinates for d2c7ff2:

Click to download the PDB-style file with coordinates for d2c7ff2.
(The format of our PDB-style files is described here.)

Timeline for d2c7ff2: