| Class b: All beta proteins [48724] (178 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
| Protein Alpha-l-arabinofuranosidase [101924] (2 species) glycosyl hydrolase family 51 |
| Species Clostridium thermocellum [TaxId:1515] [141554] (2 PDB entries) Uniprot Q4CJG5 2-16,387-502 |
| Domain d2c7fe1: 2c7f E:3-16,E:387-502 [130063] Other proteins in same PDB: d2c7fa2, d2c7fb2, d2c7fc2, d2c7fd2, d2c7fe2, d2c7ff2 automated match to d2c7fa1 complexed with ahr, edo |
PDB Entry: 2c7f (more details), 2.7 Å
SCOPe Domain Sequences for d2c7fe1:
Sequence, based on SEQRES records: (download)
>d2c7fe1 b.71.1.2 (E:3-16,E:387-502) Alpha-l-arabinofuranosidase {Clostridium thermocellum [TaxId: 1515]}
karmtvdkdykiaeXgivlqpvinsplhdtskhedvtdiesvaiyneekeevtifavnrn
ihedivlvsdvrgmkdyrllehivlehqdlkirnsvngeevypknsdkssfddgiltsml
rraswnvirig
>d2c7fe1 b.71.1.2 (E:3-16,E:387-502) Alpha-l-arabinofuranosidase {Clostridium thermocellum [TaxId: 1515]}
karmtvdkdykiaeXgivlqpvinsplhdtskhedvtdiesvaiyneekeevtifavnrn
ihedivlvsdvrgrllehivlehqdlkirnsvngeevypknsdkssiltsmlrraswnvi
rig
Timeline for d2c7fe1: